Skip to Content

ELISA Recombinant Escherichia fergusonii Electron transport complex protein RnfA(rnfA)

https://www.scicommhub.com/web/image/product.template/127309/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) Uniprot NO.:B7LQP3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVANVPAPFRGNAIALITAGLM SLAFMGFSGLVKL Protein Names:Recommended name: Electron transport complex protein RnfA Gene Names:Name:rnfA Ordered Locus Names:EFER_1416 Expression Region:1-193 Sequence Info:fµLl length protein

1,539.00 € 1539.0 EUR 1,539.00 €

1,539.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF483299EOR

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.