ELISA Recombinant Escherichia fergusonii Glycerol-3-phosphate acyltransferase(plsY)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) Uniprot NO.:B7LQD7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAIAPGMILFAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRMGGKGAALAVLI FDVLKGmLPVWGAYELGVSPFWLGLIAIAACLGHIWPIFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSmLSCLILLRHHDN IQRLWRRQETKIWTKLKRKREKDPE Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): G3P acyltransferase Short name= GPAT EC= 2.3.1.15 EC= 2.3.1.n5 Lysophosphatidic acid synthase Short name= LPA synthase Gene Names:Name:plsY Synonyms:ygiH Ordered Locus Names:EFER_3004 Expression Region:1-205 Sequence Info:fµLl length protein