Skip to Content

ELISA Recombinant Escherichia coli O7:K1 UPF0299 membrane protein yohJ(yohJ)

https://www.scicommhub.com/web/image/product.template/127039/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O7:K1 (strain IAI39 / ExPEC) Uniprot NO.:B7NMA6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKTLNIIWQYLRAFVLIYACLYAGIFIASLLPVTIPGSIIGmLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAVSTLVVFLVVSWSSQLVHG ERKVVGQKGSEE Protein Names:Recommended name: UPF0299 membrane protein yohJ Gene Names:Name:yohJ Ordered Locus Names:ECIAI39_2280 Expression Region:1-132 Sequence Info:fµLl length protein

1,474.00 € 1474.0 EUR 1,474.00 €

1,474.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days