ELISA Recombinant Escherichia coli O157:H7 UPF0114 protein YqhA(yqhA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O157:H7 (strain EC4115 / EHEC) Uniprot NO.:B5YR48 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH Protein Names:Recommended name: UPF0114 protein YqhA Gene Names:Name:yqhA Ordered Locus Names:ECH74115_4314 Expression Region:1-164 Sequence Info:fµLl length protein