ELISA Recombinant Escherichia coli O157:H7 Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O157:H7 (strain EC4115 / EHEC) Uniprot NO.:B5YPX2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:ECH74115_0713 Expression Region:1-127 Sequence Info:fµLl length protein