ELISA Recombinant Exiguobacterium sibiricum Glycerol-3-phosphate acyltransferase(plsY)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) Uniprot NO.:B1YEC6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIEIIGILILGYLLGSIPFALLVGKWGHGIDIRQHGSGNLGTTNTFRVLGKKAGIIVLIG DLGKGAVASLVPILLASELHPLFAGLAAVVGHIYPVFARFKGGKAVATSGGmLLVTSPIL FLVLLISFLTTLRLSRMVSLSSIVSASIGIVAAITIGIVEQDWIVPTFFTILALFVIFKH RENISRIRQGTESKIGMFAKDKKDTD Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati Gene Names:Name:plsY Ordered Locus Names:Exig_1149 Expression Region:1-206 Sequence Info:fµLl length protein