Skip to Content

ELISA Recombinant Exiguobacterium sibiricum UPF0365 protein Exig_0818 (Exig_0818)

https://www.scicommhub.com/web/image/product.template/127401/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) Uniprot NO.:B1YL66 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTPELLTVLLITGGILIFLAIFFTLVPIPLWISSLAAGVRVSIFTLVGMRLRRVTPSKIV NPLIKAVKAGINLNTNQLESHYLAGGNVDRVVNALIAAHRANIELSFERAAAIDLAGRNV LEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIDRLVGGAGEETVIARVGEGV ISTIGSCQDQKEVLENPEMISRTVLAKGLDSGTAFEILSIDIADVDIGKNIGAVLQTDQA EADKNIAQAKAEERRAMAIASEQEMKSRVEEMRAKVVAAEAEVPLAIAEALRDGNFSVMD YANYLNVTADTKMRQAIGGQSSPNDTQ Protein Names:Recommended name: UPF0365 protein Exig_0818 Gene Names:Ordered Locus Names:Exig_0818 Expression Region:1-327 Sequence Info:fµLl length protein

1,680.00 € 1680.0 EUR 1,680.00 €

1,680.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days