ELISA Recombinant Exiguobacterium sibiricum UPF0295 protein Exig_0660 (Exig_0660)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Uniprot NO.:B1YK60
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKQRKNKINRARNLAMFLVFGGmLVMYGGLLLKQFEIIMVILmLVGFVMVLASTALYFL IGLTSTKAAVVTCPNCGKETKVLGRVDLCMHCDEPLTMDRNLEGKEFDEKYNKHSKRAPR
Protein Names:Recommended name: UPF0295 protein Exig_0660
Gene Names:Ordered Locus Names:Exig_0660
Expression Region:1-120
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF452113EPT
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.