Skip to Content

ELISA Recombinant Exiguobacterium sibiricum UPF0295 protein Exig_0660 (Exig_0660)

https://www.scicommhub.com/web/image/product.template/127399/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) Uniprot NO.:B1YK60 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKQRKNKINRARNLAMFLVFGGmLVMYGGLLLKQFEIIMVILmLVGFVMVLASTALYFL IGLTSTKAAVVTCPNCGKETKVLGRVDLCMHCDEPLTMDRNLEGKEFDEKYNKHSKRAPR Protein Names:Recommended name: UPF0295 protein Exig_0660 Gene Names:Ordered Locus Names:Exig_0660 Expression Region:1-120 Sequence Info:fµLl length protein

1,462.00 € 1462.0 EUR 1,462.00 €

1,462.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days