ELISA Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) Uniprot NO.:B1YH82 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIR YVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSIT TLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALmLSISLRFLPTLAEETEKIMKAQQA RGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTT RDTGLILLLVALGLLLVYLRGGF Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT Gene Names:Name:ecfT Ordered Locus Names:Exig_0127 Expression Region:1-263 Sequence Info:fµLl length protein