Skip to Content

ELISA Recombinant Exiguobacterium sibiricum ATP synthase subunit c(atpE)

https://www.scicommhub.com/web/image/product.template/127394/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) Uniprot NO.:B1YEG1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELIATAIIIGLGALGAGIGNGLIVNGTVLGQARQPELKNELRQTMFIGIGLVEALPIIG VAVGFLLLNS Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpE Ordered Locus Names:Exig_2681 Expression Region:1-70 Sequence Info:fµLl length protein

1,409.00 € 1409.0 EUR 1,409.00 €

1,409.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days