ELISA Recombinant Fagopyrum esculentum subsp. ancestrale NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Fagopyrum escµLentum subsp. ancestrale (Wild buckwheat) Uniprot NO.:B2XWJ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MmLEHVLVLSAYLFSIGIYGLITSRNLVRALMCLELILNAVNLNFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGPAIVSAIYRNRKSTRINQSNLLNK Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L Gene Names:Name:ndhE Expression Region:1-101 Sequence Info:fµLl length protein