ELISA Recombinant Escherichia coli O9:H4 Zinc transporter ZupT(zupT)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia coli O9:H4 (strain HS)
Uniprot NO.:A8A4J6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGImLLISLMEmLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRmLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Protein Names:Recommended name: Zinc transporter ZupT
Gene Names:Name:zupT Ordered Locus Names:EcHS_A3217
Expression Region:1-257
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.