Skip to Content

ELISA Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)

https://www.scicommhub.com/web/image/product.template/127163/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O9:H4 (strain HS) Uniprot NO.:A8A2C5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPmLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnE Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE Gene Names:Name:arnE Ordered Locus Names:EcHS_A2403 Expression Region:1-111 Sequence Info:fµLl length protein

1,452.00 € 1452.0 EUR 1,452.00 €

1,452.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF425183EJF

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.