ELISA Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O9:H4 (strain HS)
Uniprot NO.:A8A2C5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPmLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnE Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Gene Names:Name:arnE Ordered Locus Names:EcHS_A2403
Expression Region:1-111
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF425183EJF
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.