Skip to Content

ELISA Recombinant Escherichia coli O139:H28 Spermidine export protein MdtI(mdtI)

https://www.scicommhub.com/web/image/product.template/126741/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O139:H28 (strain E24377A / ETEC) Uniprot NO.:A7ZM58 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA Protein Names:Recommended name: Spermidine export protein MdtI Gene Names:Name:mdtI Ordered Locus Names:EcE24377A_1806 Expression Region:1-109 Sequence Info:fµLl length protein

1,450.00 € 1450.0 EUR 1,450.00 €

1,450.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF425080EJD

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.