Skip to Content

ELISA Recombinant Escherichia coli O139:H28 Lipoprotein signal peptidase(lspA)

https://www.scicommhub.com/web/image/product.template/126721/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O139:H28 (strain E24377A / ETEC) Uniprot NO.:A7ZHB6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKKQ Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II Gene Names:Name:lspA Ordered Locus Names:EcE24377A_0027 Expression Region:1-164 Sequence Info:fµLl length protein

1,508.00 € 1508.0 EUR 1,508.00 €

1,508.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.