ELISA Recombinant Escherichia coli O9:H4 Nickel-cobalt efflux system rcnA(rcnA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O9:H4 (strain HS) Uniprot NO.:A8A1X1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTEFTTLLQQGNAWFFIPSVILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVmLGLAAT ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIISTAFWMFWRTWRGERNWLENM HGHDYEHHHHDHEHHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSIGLALTLVTVGVGAAISVQQVAKRWS GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR Protein Names:Recommended name: Nickel/cobalt efflux system rcnA Gene Names:Name:rcnA Ordered Locus Names:EcHS_A2242 Expression Region:1-274 Sequence Info:fµLl length protein