Skip to Content

ELISA Recombinant Flavobacterium psychrophilum Large-conductance mechanosensitive channel(mscL)

https://www.scicommhub.com/web/image/product.template/127443/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) Uniprot NO.:A6GYI6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGFFADFKASLMKGDVLSLATAVVIGGAFGKIVGSAVDDIIMPIVGVLTGGVDFTTKFIA LNGQSYADLAAAKTAGAACLTYGNLVQAIINFIIISFFIFVVLRAAEKAKKKEEAAPTAP AGPSQEELLTQIRDLLKK Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:FP1065 Expression Region:1-138 Sequence Info:fµLl length protein

1,481.00 € 1481.0 EUR 1,481.00 €

1,481.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days