ELISA Recombinant Flavobacterium johnsoniae Potassium-transporting ATPase C chain(kdpC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) (Cytophaga johnsonae)
Uniprot NO.:A5FIF7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKNLFSLLKLTVFTLILFAVIYPLAIYGIAKLAPNQGKGETISVNGKVVGYQKIGQKFDK SNYFWGRPSAVDYNAAGSAGSNKGPSNADYLALVQKRIDTLLLVHPYLKKSDIPVDMVTA SGSGLDPNISPQGALIQVKRIAKERmLDEAKVKSLVESKINTAVVGPETVNVLELNVALD QLK
Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain
Gene Names:Name:kdpC Ordered Locus Names:Fjoh_1973
Expression Region:1-183
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF400010FDT
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.