Skip to Content

ELISA Recombinant Flavobacterium johnsoniae Potassium-transporting ATPase C chain(kdpC)

https://www.scicommhub.com/web/image/product.template/127441/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) (Cytophaga johnsonae) Uniprot NO.:A5FIF7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNLFSLLKLTVFTLILFAVIYPLAIYGIAKLAPNQGKGETISVNGKVVGYQKIGQKFDK SNYFWGRPSAVDYNAAGSAGSNKGPSNADYLALVQKRIDTLLLVHPYLKKSDIPVDMVTA SGSGLDPNISPQGALIQVKRIAKERmLDEAKVKSLVESKINTAVVGPETVNVLELNVALD QLK Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain Gene Names:Name:kdpC Ordered Locus Names:Fjoh_1973 Expression Region:1-183 Sequence Info:fµLl length protein

1,528.00 € 1528.0 EUR 1,528.00 €

1,528.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF400010FDT

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.