Skip to Content

ELISA Recombinant European bat lyssavirus 1 Glycoprotein G(G)

https://www.scicommhub.com/web/image/product.template/127389/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:European bat lyssavirus 1 (strain Bat/Germany/RV9/1968) (EBLV1) Uniprot NO.:A4UHQ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:KFPIYTIPDKIGPWSPIDINHLSCPNNLIVEDEGCTTLTPFSYMELKVGYITTIKIEGFT CTGVITEAETYTNFVGYVTTTFKRKHFRPTVSACRDAYNWKITGDPRYEESLHNPYPDSH WLRTVKTTKESLLIISPSVVDMDAYDKNLYSKMFPNGKCLASPPSAICCPTNHDYTIWIP ENPKPGLSCDIFTTSKGKKATKDGRLCGFVDERGLYKSLKGACKQRLCGVPGMRLMDGSW VSLQKTEAPEWCSPDQLVNVHDFHTDEIEHLVVEELVKKREECLDALETIITTKSISFRR LSHFRKLVPGFGKAYTLINKTLMEADAHYKSVREWKEVIPSKGCLMAGGRCHPHYSGIFF NGIILSPGGDVLIPEMQSALLQQHIELLESSMIPLRHPLADPSTVFKRDDEAEDFVEVHL PDTQKLISGIDLGFPEWKRYFLIGISVLALLALAIITAACCKRFKRRRRPKPNPIELIRK VSVTSQSGRAIPSWESYKVGATGES Protein Names:Recommended name: Glycoprotein G Gene Names:Name:G Expression Region:20-524 Sequence Info:fµLl length protein

1,868.00 € 1868.0 EUR 1,868.00 €

1,868.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF395884EJH

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.