ELISA Recombinant Ferrous-iron efflux pump FieF(fieF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O1:K1 / APEC Uniprot NO.:A1AI91 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVV RYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLVSPTPMTDPGVGVIV TIVALICTIILVSFQRWVVRRTQSQAVRADmLHYQSDVMMNGAILLALGLSWYGWHRADA LFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSG PTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVVPREGKRSmLS Protein Names:Recommended name: Ferrous-iron efflux pump FieF Gene Names:Name:fieF Ordered Locus Names:Ecok1_38870 ORF Names:APECO1_2554 Expression Region:1-300 Sequence Info:fµLl length protein