ELISA Recombinant Escherichia coli Spermidine-putrescine transport system permease protein PotB(potB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AFK4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLN MALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYL NEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGAS KLQTFIRIIIPLTMPGIIAGCLLVmLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDW PFGAATSITLTIVMGLmLLVYWRASRLLNKKVELE Protein Names:Recommended name: Spermidine/putrescine transport system permease protein PotB Gene Names:Name:potB Ordered Locus Names:b1125, JW1111 Expression Region:1-275 Sequence Info:fµLl length protein