ELISA Recombinant Escherichia coli Glycerol uptake facilitator protein(glpF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AER0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL Protein Names:Recommended name: Glycerol uptake facilitator protein Alternative name(s): Aquaglyceroporin Gene Names:Name:glpF Ordered Locus Names:b3927, JW3898 Expression Region:1-281 Sequence Info:fµLl length protein