Skip to Content

ELISA Recombinant Escherichia coli Glutamine transport system permease protein glnP(glnP)

https://www.scicommhub.com/web/image/product.template/125773/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AEQ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQFDWSAIWPAIPLLIEGAKMTLWISVLGLAGGLVIGLLAGFARTFGGWIANHVALVFIE VIRGTPIVVQVMFIYFALPMAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGF REAGLALGLSRWETIRYVILPLALRRmLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEI IAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL Protein Names:Recommended name: Glutamine transport system permease protein glnP Gene Names:Name:glnP Ordered Locus Names:b0810, JW0795 Expression Region:1-219 Sequence Info:fµLl length protein

1,566.00 € 1566.0 EUR 1,566.00 €

1,566.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF365181ENV

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.