Skip to Content

ELISA Recombinant Escherichia coli Lipid A biosynthesis lauroyl acyltransferase(htrB)

https://www.scicommhub.com/web/image/product.template/125891/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0ACV0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTNLPKFSTALLHPRYWLTWLGIGVLWLVVQLPYPVIYRLGCGLGKLALRFMKRRAKIVH RNLELCFPEMSEQERRKMVVKNFESVGMGLMETGMAWFWPDRRIARWTEVIGMEHIRDVQ AQKRGILLVGIHFLTLELGARQFGMQEPGIGVYRPNDNPLIDWLQTWGRLRSNKSmLDRK DLKGMIKALKKGEVVWYAPDHDYGPRSSVFVPLFAVEQAATTTGTWmLARMSGACLVPFV PRRKPDGKGYQLImLPPECSPPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPE GVPSRY Protein Names:Recommended name: Lipid A biosynthesis lauroyl acyltransferase EC= 2.3.1.- Alternative name(s): Heat shock protein B Gene Names:Name:htrB Synonyms:waaM Ordered Locus Names:b1054, JW1041 Expression Region:1-306 Sequence Info:fµLl length protein

1,658.00 € 1658.0 EUR 1,658.00 €

1,658.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF364865ENV

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.