ELISA Recombinant Escherichia coli Probable formate transporter 1(focA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AC23 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH Protein Names:Recommended name: Probable formate transporter 1 Alternative name(s): Formate channel 1 Gene Names:Name:focA Synonyms:ycaE Ordered Locus Names:b0904, JW0887 Expression Region:1-285 Sequence Info:fµLl length protein