Skip to Content

ELISA Recombinant Escherichia coli Inner membrane protein CreD(creD)

https://www.scicommhub.com/web/image/product.template/125805/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P08369 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLKSPLFWKMTSLFGAVLLLLIPImLIRQVIVERADYRSDVEDAIRQSTSGPQKLVGPLI AIPVTELYTVQEEDKTVERKRSFIHFWLPESLMVDGNQNVEERKIGIYTGQVWHSDLTLK ADFDVSRLSELNAPNITLGKPFIVISVGDARGIGVVKAPEVNGTALTIEPGTGLEQGGQG VHIPLPEGDWRKQNLKLNMALNLSGTGDLSVVPGGRNSEMTLTSNWPHPSFLGDFLPAKR EVSESGFQAHWQSSWFANNLGERFASGNDTGWENFPAFSVAVTTPADQYQLTDRATKYAI LLIALTFMAFFVFETLTAQRLHPMQYLLVGLSLVMFYLLLLALSEHTGFTVAWIIASLIG AIMNGIYLQAVLKGWCNSmLFTLALLLLDGVMWGLLNSADSALLLGTSVLVVALAGMMFV TRNIDWYAFSLPKMKASKEVTTDDELRIWK Protein Names:Recommended name: Inner membrane protein CreD Gene Names:Name:creD Synonyms:cet Ordered Locus Names:b4400, JW4363 Expression Region:1-450 Sequence Info:fµLl length protein

1,810.00 € 1810.0 EUR 1,810.00 €

1,810.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF362406ENV

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.