ELISA Recombinant Escherichia coli Homoserine-homoserine lactone efflux protein(rhtB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AG34 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVG LGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNL TNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMIGYATLAQRIALWIKGPK QMKALNKIFGSLFmLVGALLASARHA Protein Names:Recommended name: Homoserine/homoserine lactone efflux protein Gene Names:Name:rhtB Synonyms:yigK Ordered Locus Names:b3824, JW5585 Expression Region:1-206 Sequence Info:fµLl length protein