Skip to Content

ELISA Recombinant Escherichia coli Uncharacterized protein YhiD(yhiD)

https://www.scicommhub.com/web/image/product.template/126270/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AFV2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLD HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSmLDWFKQQKIKTDLVSLQENED HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS Protein Names:Recommended name: Uncharacterized protein YhiD Gene Names:Name:yhiD Synonyms:yhhE Ordered Locus Names:b3508, JW5670 Expression Region:1-215 Sequence Info:fµLl length protein

1,562.00 € 1562.0 EUR 1,562.00 €

1,562.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days