ELISA Recombinant Escherichia coli Nickel transport system permease protein nikC(nikC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AFA9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF VDHLAGAVIPSLLVLATLDIGHMmLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH Protein Names:Recommended name: Nickel transport system permease protein nikC Gene Names:Name:nikC Ordered Locus Names:b3478, JW3443 Expression Region:1-277 Sequence Info:fµLl length protein