ELISA Recombinant Escherichia coli Glutamate-aspartate transport system permease protein gltK(gltK)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AER5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTmLAVMRLSSFAPVAWFAKAYV NVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA Protein Names:Recommended name: Glutamate/aspartate transport system permease protein gltK Gene Names:Name:gltK Ordered Locus Names:b0653, JW0648 Expression Region:1-224 Sequence Info:fµLl length protein