ELISA Recombinant Escherichia coli Uncharacterized membrane protein yhhN(yhhN)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P0ADI9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:mLWSFIAVCLSAWLSVDASYRGPTWQRWVFKPLTLLLLLLLAWQAPMFDAISYLVLAGLC ASLLGDALTLLPRQRLMYAIGAFFLSHLLYTIYFASQMTLSFFWPLPLVLLVLGALLLAI IWTRLEEYRWPICTFIGMTLVMVWLAGELWFFRPTAPALSAFVGASLLFISNFVWLGSHY RRRFRADNAIAAACYFAGHFLIVRSLYL
Protein Names:Recommended name: Uncharacterized membrane protein yhhN
Gene Names:Name:yhhN Ordered Locus Names:b3468, JW3433
Expression Region:1-208
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF359954ENV
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.