Skip to Content

ELISA Recombinant Escherichia coli UPF0721 transmembrane protein yfcA(yfcA)

https://www.scicommhub.com/web/image/product.template/126406/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AD30 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METFNSLFMVSPLLLGVLFFVAmLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ ACGGSISATIYFIRRKVVSLSDQKLNIAMTFVGSMSGALLVQYVQADVLRQILPILVICI GLYFLLMPKLGEEDRQRRMYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGFNLA KATAHAKLLNATSNIGGLLLFILGGKVIWATGFVmLVGQFLGARMGSRLVLSKGQKLIRP MIVIVSAVMSAKLLYDSHGQEILHWLGMN Protein Names:Recommended name: UPF0721 transmembrane protein yfcA Gene Names:Name:yfcA Ordered Locus Names:b2327, JW2324 Expression Region:1-269 Sequence Info:fµLl length protein

1,619.00 € 1619.0 EUR 1,619.00 €

1,619.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days