ELISA Recombinant Flagellar protein FliL(fliL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O157:H7 Uniprot NO.:P0ABY0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQRVVPSPVFYALD TFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKK NLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFILR Protein Names:Recommended name: Flagellar protein FliL Gene Names:Name:fliL Ordered Locus Names:Z3034, ECs2683 Expression Region:1-154 Sequence Info:fµLl length protein