ELISA Recombinant Escherichia coli Pilin(traA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P04737 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVF IAVGMAVVGL Protein Names:Recommended name: Pilin Alternative name(s): F-pilin Gene Names:Name:traA Ordered Locus Names:ECOK12F074 Expression Region:52-121 Sequence Info:fµLl length protein