ELISA Recombinant Escherichia coli Inner membrane protein yqjE(yqjE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P64585
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVELEEEKANLFQLLLmLGLTmLF AAFGLMSLMVLIIWAVDPQYRLNAMIATTVVLLLLALIGGIWTLRKSRKSTLLRHTRHEL ANDRQLLEEESREQ
Protein Names:Recommended name: Inner membrane protein yqjE
Gene Names:Name:yqjE Ordered Locus Names:b3099, JW3070
Expression Region:1-134
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF354930ENV
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.