ELISA Recombinant Escherichia coli UPF0053 inner membrane protein ygdQ(ygdQ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P67127 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQRAHARRLGLAGAMVMR LALLASIAWVTRLTNPLFTIFSQEISARDLILLLGGLFLIWKASKEIHESIEGEEEGLKT RVSSFLGAIVQImLLDIIFSLDSVITAVGLSDHLFIMMAAVVIAVGVMMFAARSIGDFVE RHPSVKmLALSFLILVGFTLILESFDIHVPKGYIYFAMFFSIAVESLNLIRNKKNPL Protein Names:Recommended name: UPF0053 inner membrane protein ygdQ Gene Names:Name:ygdQ Ordered Locus Names:b2832, JW2800 Expression Region:1-237 Sequence Info:fµLl length protein