ELISA Recombinant Escherichia coli O127:H6 UPF0410 protein ymge(ymgE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Uniprot NO.:P58767
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIIAWIIFGLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFN LHSFLVAVVGAILVLGVFRLLQRE
Protein Names:Recommended name: UPF0410 protein ymge Alternative name(s): Transglycosylase-associated gene protein
Gene Names:Name:ymgE Synonyms:tag Ordered Locus Names:E2348C_1314
Expression Region:1-84
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF348354EOB
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.