Skip to Content

ELISA Recombinant Escherichia coli O127:H6 UPF0410 protein ymge(ymgE)

https://www.scicommhub.com/web/image/product.template/126695/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O127:H6 (strain E2348/69 / EPEC) Uniprot NO.:P58767 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGIIAWIIFGLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFN LHSFLVAVVGAILVLGVFRLLQRE Protein Names:Recommended name: UPF0410 protein ymge Alternative name(s): Transglycosylase-associated gene protein Gene Names:Name:ymgE Synonyms:tag Ordered Locus Names:E2348C_1314 Expression Region:1-84 Sequence Info:fµLl length protein

1,424.00 € 1424.0 EUR 1,424.00 €

1,424.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF348354EOB

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.