Skip to Content

ELISA Recombinant Escherichia coli UPF0603 protein ygcG(ygcG)

https://www.scicommhub.com/web/image/product.template/126402/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P55140 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AQPTIVPQLQQQVTDLTSSLNSQEKKELTHKLESIFNNTQVQIAVLIVPTTKDETIEQYA TRVFDNWRLGDAKRNDGILIVVAWSDRTVRIQVGYGLEEKVTDALAGDIIRSNMIPAFKQ QKLAKGLELAINALNNQLTSQHQYPTNPSESESASSSDHYYFAIFWVFAVMFFPFWFFHQ GSNFCRACKSGVCISAIYLLDLFLFSDKIFSIAVFSFFFTFTIFMVFTCLCVLQKRASGR SYHSDNSGSAGGSDSGGFSGGGGSSGGGGASGRW Protein Names:Recommended name: UPF0603 protein ygcG Gene Names:Name:ygcG Ordered Locus Names:b2778, JW5445 Expression Region:17-290 Sequence Info:fµLl length protein

1,624.00 € 1624.0 EUR 1,624.00 €

1,624.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days