Skip to Content

ELISA Recombinant Flaveria trinervia Triose phosphate-phosphate translocator, chloroplastic(TPT)

https://www.scicommhub.com/web/image/product.template/127436/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Flaveria trinervia (Clustered yellowtops) (Oedera trinervia) Uniprot NO.:P49132 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ATASDSAGDAAPVGFLAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHL AVGVVYCLGSWTVGLPKRAPVDSNILKLLIPVGFCHALGHVTSNVSFAAVAVSFTHTIKA LEPFFNAAASQFVLGQSIPISLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTY RSIYSKKAMTDMDSTNLYAYISIIALLFCIPPAVLFEGPQLLKHGFNDAIAKVGMIKFIS DLFWVGMFYHLYNQIATNTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNKISTQTAIGTS IAIAGVAIYSLIKARIEEEKRRMKSA Protein Names:Recommended name: Triose phosphate/phosphate translocator, chloroplastic Short name= cTPT Gene Names:Name:TPT Expression Region:82-407 Sequence Info:fµLl length protein

1,679.00 € 1679.0 EUR 1,679.00 €

1,679.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days