ELISA Recombinant Escherichia coli Uncharacterized protein yjfZ(yjfZ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P39308 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLPTTIYSFPAYLSRFSSTDKPVKLKFHQYARATLLSNRGRDHNCDGRRTVEIHKLDLS DWQAFNKLATRCNAYDGITMNGDNSFGWNHEATLDNIHAQKYNKAYAGARLTAELKYLLQ DVESFEPNSKYTIHEVVLGPGYGTPDYTGQTIGYVVTLPAQMPNCWSSELPTIDLYIDQL RTVTGVSNALGFIIAALLNAYSDLPHDLKIGLRSLSSSAAIYSGLGFERVPQERDISCAR MYLTPANHPDLWTQENGEWIYLRN Protein Names:Recommended name: Uncharacterized protein yjfZ Gene Names:Name:yjfZ Ordered Locus Names:b4204, JW4162 Expression Region:1-264 Sequence Info:fµLl length protein