ELISA Recombinant Escherichia coli Superinfection exclusion protein B(sieB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P38392 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLDVFTPLLKLFANEPLERLMYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFS FVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKK LERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSRRFNR Protein Names:Recommended name: Superinfection exclusion protein B Gene Names:Name:sieB Ordered Locus Names:b1353, JW5209 Expression Region:1-162 Sequence Info:fµLl length protein