ELISA Recombinant Escherichia coli Probable acyltransferase yihG(yihG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P32129 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANLLNKFIMTRILAAITLLLSIVLTILVTIFCSVPIIIAGIVKLLLPVPVIWRKVSRFC DFMMYCWCEGLAVLLHLNPHLQWEVHGLEGLSKKNWYLLICNHRSWADIVVLCVLFRKHI PMNKYFLKQQLAWVPFLGLACWSLDMPFMKRYSRAYLLRHPERRGKDVETTRRSCEKFRL HPTTIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAGIAMALNVLGKQFDKLLNVTLCYPD NNRQPFFDmLSGKLTRIVVHVDLQPIADELHGDYINDKSFKRHFQQWLNSLWQEKDRLLT SLMSSQRQNK Protein Names:Recommended name: Probable acyltransferase yihG EC= 2.3.-.- Gene Names:Name:yihG Ordered Locus Names:b3862, JW3834 Expression Region:1-310 Sequence Info:fµLl length protein