Skip to Content

ELISA Recombinant Escherichia coli Type 4 prepilin-like proteins leader peptide-processing enzyme(gspO)

https://www.scicommhub.com/web/image/product.template/126235/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P25960 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTmLLPLFILVGFIADYFVNAIAYHLSPLEDKTALTFRQVLVHFRQKKYAWHDTVPLILC VAAAIACALAPFTPIVTGALFLYFCFVLTLSVIDFRTQLLPDKLTLPLLWLGLVFNAQYG LIDLHDAVYGAVAGYGVLWCVYWGVWLVCHKEGLGYGDFKLLAAAGAWCGWQTLPMILLI ASLGGIGYAIVSQLLQRRTITTIAFGPWLALGSMINLGYLAWISY Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prepilin peptidase N-methyltransferase EC= 2.1.1.- Gene Names:Name:gspO Synonyms:hofD, hopD, hopO, yheC Ordered Locus Names:b3335, JW3297 Expression Region:1-225 Sequence Info:fµLl length protein

1,572.00 € 1572.0 EUR 1,572.00 €

1,572.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.