Skip to Content

ELISA Recombinant Escherichia coli N-acetylgalactosamine permease IID component(agaD)

https://www.scicommhub.com/web/image/product.template/125936/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P42911 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAmLPILKKIYKDDKPGLSAAMKDN LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK AHPVLLIGVTFVLSIVCSAFGIL Protein Names:Recommended name: N-acetylgalactosamine permease IID component Alternative name(s): EIID-Aga PTS system N-acetylgalactosamine-specific EIID component Gene Names:Name:agaD Synonyms:yraF Ordered Locus Names:b3140, JW3109 Expression Region:1-263 Sequence Info:fµLl length protein

1,613.00 € 1613.0 EUR 1,613.00 €

1,613.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days