ELISA Recombinant Escherichia coli N-acetylgalactosamine permease IID component(agaD)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P42911
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAmLPILKKIYKDDKPGLSAAMKDN LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK AHPVLLIGVTFVLSIVCSAFGIL
Protein Names:Recommended name: N-acetylgalactosamine permease IID component Alternative name(s): EIID-Aga PTS system N-acetylgalactosamine-specific EIID component
Gene Names:Name:agaD Synonyms:yraF Ordered Locus Names:b3140, JW3109
Expression Region:1-263
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.