ELISA Recombinant Escherichia coli Putative N-acetylgalactosamine permease IIC component 2(agaW)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P42905
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVW MGLAPLAGAQPPNVIIGTIVGTAFAITTGVKPDVAVGVAVPFAVAVQMGITFLFSVMSGV MSRCDLATNPRRI
Protein Names:Recommended name: Putative N-acetylgalactosamine permease IIC component 2 Alternative name(s): EIIC-Aga' PTS system N-acetylgalactosamine-specific EIIC component 2
Gene Names:Name:agaW Ordered Locus Names:b3134
Expression Region:1-133
Sequence Info:fµLl length protein