Skip to Content

ELISA Recombinant Escherichia coli Putative N-acetylgalactosamine permease IIC component 2(agaW)

https://www.scicommhub.com/web/image/product.template/126142/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P42905 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVW MGLAPLAGAQPPNVIIGTIVGTAFAITTGVKPDVAVGVAVPFAVAVQMGITFLFSVMSGV MSRCDLATNPRRI Protein Names:Recommended name: Putative N-acetylgalactosamine permease IIC component 2 Alternative name(s): EIIC-Aga' PTS system N-acetylgalactosamine-specific EIIC component 2 Gene Names:Name:agaW Ordered Locus Names:b3134 Expression Region:1-133 Sequence Info:fµLl length protein

1,475.00 € 1475.0 EUR 1,475.00 €

1,475.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF337255ENV

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.