Skip to Content

ELISA Recombinant Escherichia coli Nickel transport system permease protein nikB(nikB)

https://www.scicommhub.com/web/image/product.template/125950/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P33591 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLRYVLRRFLLLIPMVLAASVIIFLmLRLGTGDPALDYLRLSNLPPTPEmLASTRTmLGL DQPLYVQYGTWLWKALHLDFGISFASQRPVLDDmLNFLPATLELAGAALVLILLTSVPLG IWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGWQHIILPA VSIAFMSLAINARLLRASmLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGM HIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNA ALDPRIRRHEGAHA Protein Names:Recommended name: Nickel transport system permease protein nikB Gene Names:Name:nikB Ordered Locus Names:b3477, JW3442 Expression Region:1-314 Sequence Info:fµLl length protein

1,666.00 € 1666.0 EUR 1,666.00 €

1,666.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days