ELISA Recombinant Escherichia coli Inner membrane protein CbrB(cbrB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P31468 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLWVIIHPIFLLLSITTGAIPAL LTGVMVACLPEKIGSQKRYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGDSL VVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS Protein Names:Recommended name: Inner membrane protein CbrB Alternative name(s): CreB-regµLated gene B protein Gene Names:Name:cbrB Synonyms:yieI Ordered Locus Names:b3716, JW3694 Expression Region:1-155 Sequence Info:fµLl length protein