Skip to Content

ELISA Recombinant Escherichia coli Putative type II secretion system protein L(gspL)

https://www.scicommhub.com/web/image/product.template/126152/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P45763 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPESLMVIRSSSTLRKHWEWMTFSADSVSSVHTLTDDLPLESLADQPGAGNVHLLIPPEG LLYRSLTLPNAKYKLTAQTLQWLAEETLPDNTQDWHWTVVDKQNESVEVIGIQSEKLSRY LERLHTAGLNVTRVLPDGCYLPWEVDSWTLVNQQTSWLIRSAAHAFNELDEHWLQHLAAQ FPPENmLCYGVVPHGVAAANPLIQHPEIPSLSLYSADIAFQRYDmLHGIFRKQKTVSKSG KWLARLAVSCLVLAILSFVGSRSIALWHTLKIEDQLQQQQQETWQRYFPQIKRTHNFRFY FKQQLAQQYPEAVPLLYHLQTLLLEHPELQLMEANYSQKQKSLTLKMSAKSEANIDRFCE LTQSWLPMEKTEKDPVSGVWTVRNSGK Protein Names:Recommended name: Putative type II secretion system protein L Short name= T2SS protein L Alternative name(s): Putative general secretion pathway protein L Gene Names:Name:gspL Synonyms:yheK Ordered Locus Names:b3333, JW5705 Expression Region:1-387 Sequence Info:fµLl length protein

1,743.00 € 1743.0 EUR 1,743.00 €

1,743.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days