Skip to Content

ELISA Recombinant Escherichia coli UPF0716 protein fxsA(fxsA)

https://www.scicommhub.com/web/image/product.template/126404/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P37147 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQ KMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSR MPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD Protein Names:Recommended name: UPF0716 protein fxsA Alternative name(s): Suppressor of F exclusion of phage T7 Gene Names:Name:fxsA Synonyms:yjeG Ordered Locus Names:b4140, JW4100 Expression Region:1-158 Sequence Info:fµLl length protein

1,502.00 € 1502.0 EUR 1,502.00 €

1,502.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days