ELISA Recombinant Escherichia coli Putrescine transport system permease protein PotH(potH)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P31135 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTLEPAAQSKPPGGFKLWLSQLQMKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMA RAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPL AWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTI LHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGG IIAGSmLVFIPAVGEFVIPELLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIImLLLLIV PIMWFHKHQQKSVGEHG Protein Names:Recommended name: Putrescine transport system permease protein PotH Gene Names:Name:potH Ordered Locus Names:b0856, JW0840 Expression Region:1-317 Sequence Info:fµLl length protein